PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G157700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 287aa    MW: 30563.5 Da    PI: 8.7814
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G157700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W++eEde+l  +v+++G g +W + +++ g++R++k+c++rw++yl
  Sevir.3G157700.1.p 14 RGPWSPEEDEQLRSYVQRHGIGgNWIALPQKAGLNRCGKSCRLRWLNYL 62
                        89******************999************************97 PP

2Myb_DNA-binding36.21.4e-1171111446
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          T++Ed+++  +    G++ W+ Ia++++ gRt++++k++w++
  Sevir.3G157700.1.p  71 YTEQEDQIIWSLYSSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                         69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.813966IPR017930Myb domain
SuperFamilySSF466893.13E-2811109IPR009057Homeodomain-like
SMARTSM007176.3E-121364IPR001005SANT/Myb domain
PfamPF002499.4E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-241569IPR009057Homeodomain-like
CDDcd001672.02E-91662No hitNo description
PROSITE profilePS5129414.5867117IPR017930Myb domain
SMARTSM007172.4E-1067115IPR001005SANT/Myb domain
PfamPF002492.3E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2170116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDEQLRSYVQ RHGIGGNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPNIKHGG YTEQEDQIIW SLYSSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAMAA  120
VAASAATGRA FAAPATPPPA LSPAASASSS VTSSGGDVRF AAYPPQHHQG LTMRFDAPAP  180
QRRQQHTELA PVPPAAAVAQ LDATSGVWAR QPAPASDAVA AALDDVFLPD LVGGGEQLFP  240
YGDFFGGLQD RAALELSACY FPNMAEMWGA AAASDAKPQG LCNTLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794301e-174HF679430.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB24 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961299.10.0PREDICTED: transcription factor RAX2-like
TrEMBLK3Z8K40.0K3Z8K4_SETIT; Uncharacterized protein
STRINGSi022874m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-69myb domain protein 36